PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009600359.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 288aa    MW: 31896.1 Da    PI: 8.9144
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009600359.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+++++ +G g+W++ +   g+ R++k+c++rw +yl
   XP_009600359.1 14 KGAWTKEEDQRLINYIRSHGEGCWRSLPTAAGLQRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding58.91.1e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++ +lG++ W+ Ia +++ gRt++++k++w+++
   XP_009600359.1  67 RGNFTEEEDELIIKLHSLLGNK-WSVIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.398961IPR017930Myb domain
SuperFamilySSF466897.75E-3013108IPR009057Homeodomain-like
SMARTSM007172.2E-121363IPR001005SANT/Myb domain
PfamPF002493.1E-151461IPR001005SANT/Myb domain
CDDcd001674.82E-101661No hitNo description
PROSITE profilePS5129428.49962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2865117IPR009057Homeodomain-like
SMARTSM007177.9E-1866114IPR001005SANT/Myb domain
PfamPF002496.8E-1767111IPR001005SANT/Myb domain
CDDcd001671.00E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0090378Biological Processseed trichome elongation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLINYIR SHGEGCWRSL PTAAGLQRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK LHSLLGNKWS VIAGRLPGRT DNEIKNYWNT HIKRKLISRG  120
IDPQSHRPLN AAATNTTASA VTTTISTTTT KNICMDFKNN VDQKPNIINQ RNNTTDSSYD  180
ETKCNSGTTE ETKPLEIPQK SSQQLMINLE LSIGLPLHTK TDHISSAEST ASYNFLAAVA  240
PPQTAAVPVT AAAEMVAKAV CLCWQIGFQG GGQSCGKCKT ATGFYRYC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30141167108B-MYB
1h8a_C4e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00053PBMTransfer from AT1G22640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009600359.10.0PREDICTED: myb-related protein 330-like
SwissprotP813951e-108MYB30_ANTMA; Myb-related protein 330
TrEMBLM1D3I01e-150M1D3I0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000804271e-149(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.13e-89myb domain protein 3